We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RPP25L Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence-RPP25LAntibody- [NBP2-13259] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Staining of human prostate shows weak cytoplasmic and membranous positivity in glandular cells.
Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RPP25L Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPP25L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPP25L Recombinant Protein Antigen (NBP2-13259PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RPP25L Antibody - BSA Free

  • alba-like protein C9orf23
  • bA296L22.5
  • C9orf23
  • chromosome 9 open reading frame 23
  • MGC29635
  • ribonuclease P/MRP 25kDa subunit-like

Background

C9orf23 encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPP25L Antibody (NBP2-13259) (0)

There are no publications for RPP25L Antibody (NBP2-13259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP25L Antibody (NBP2-13259) (0)

There are no reviews for RPP25L Antibody (NBP2-13259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPP25L Antibody (NBP2-13259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPP25L Products

Research Areas for RPP25L Antibody (NBP2-13259)

Find related products by research area.

Blogs on RPP25L

There are no specific blogs for RPP25L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP25L Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP25L