RPL7L1 Antibody


Immunocytochemistry/ Immunofluorescence: RPL7L1 Antibody [NBP2-54939] - Staining of human cell line HEK 293 shows localization to nucleoli.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF

Order Details

RPL7L1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN
Specificity of human RPL7L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL7L1 Recombinant Protein Antigen (NBP2-54939PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RPL7L1 Antibody

  • dJ475N16.4,60S ribosomal protein L7-like 1
  • MGC62004
  • ribosomal protein L7-like 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPL7L1 Antibody (NBP2-54939) (0)

There are no publications for RPL7L1 Antibody (NBP2-54939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL7L1 Antibody (NBP2-54939) (0)

There are no reviews for RPL7L1 Antibody (NBP2-54939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL7L1 Antibody (NBP2-54939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RPL7L1 Antibody (NBP2-54939)

Discover related pathways, diseases and genes to RPL7L1 Antibody (NBP2-54939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RPL7L1

There are no specific blogs for RPL7L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPL7L1 Antibody and receive a gift card or discount.


Gene Symbol RPL7L1