We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RNF212 Recombinant Protein Antigen

Images

 
There are currently no images for RNF212 Recombinant Protein Antigen (NBP2-49259PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNF212 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF212.

Source: E. coli

Amino Acid Sequence: KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF212
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49259.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNF212 Recombinant Protein Antigen

  • FLJ38841
  • FLJ42587
  • hypothetical protein LOC285498
  • MGC120227
  • MGC120228
  • ring finger protein 212
  • ZHP3

Background

RNF212, also known as Probable E3 SUMO-protein ligase RNF212, has 6 isoforms, a 297 amino acid isoform that is 33 kDa, a 123 amino acid isoform that is 14 kDa, a 192 amino acid isoform that is 22 kDa, a 280 amino acid isoform that is 31 kDa, a 232 amino acid isoform that is 26 kDa, and a 273 amino acid isoform that is 30 kDa. This protein may function as a ubiquitin ligase and may be involved in meiotic recombination, regulates crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes, localizes to recombination sites and stabilizes meiosis-specific recombination factors, may act as a SUMO E3 ligase that mediates sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites, and acts as a limiting factor for crossover designation and/or reinforcement.RNF212 protein is being studied for its involvement in recombination rate qtl 1 disorder. Little is currently known about this protein interactions with other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80118
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-03897
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB400-149
Species: Bv, Hu, Mu, Rt(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87144
Species: Hu
Applications: IHC,  IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
NBP2-49259PEP
Species: Hu
Applications: AC

Publications for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)

There are no publications for RNF212 Recombinant Protein Antigen (NBP2-49259PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)

There are no reviews for RNF212 Recombinant Protein Antigen (NBP2-49259PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF212 Products

Blogs on RNF212

There are no specific blogs for RNF212, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNF212 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF212