RNF212 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF212. Source: E. coli
Amino Acid Sequence: KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RNF212 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-49259.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for RNF212 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)
There are no publications for RNF212 Recombinant Protein Antigen (NBP2-49259PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)
There are no reviews for RNF212 Recombinant Protein Antigen (NBP2-49259PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RNF212 Recombinant Protein Antigen (NBP2-49259PEP) (0)
Other Available Formats
Additional RNF212 Products
Bioinformatics Tool for RNF212 Recombinant Protein Antigen (NBP2-49259PEP)
Discover related pathways, diseases and genes to RNF212 Recombinant Protein Antigen (NBP2-49259PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for RNF212 Recombinant Protein Antigen (NBP2-49259PEP)
Discover more about diseases related to RNF212 Recombinant Protein Antigen (NBP2-49259PEP).
| | Pathways for RNF212 Recombinant Protein Antigen (NBP2-49259PEP)
View related products by pathway.
|
Blogs on RNF212
![Western Blot: PRDM9 Antibody [NBP1-80118] - Host: Rabbit. Target Name: PRDM9. Sample Type: 293T. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/PRDM9-Antibody-Western-Blot-NBP1-80118-img0009.jpg)
![Immunohistochemistry: PRDM9 Antibody [NBP1-80118] - Paraffin Embedded Tissue: Human Placenta Antibody Concentration: 5 ug/ml](http://images.novusbio.com/fullsize2/PRDM9-Antibody-Immunohistochemistry-NBP1-80118-img0007.jpg)
![Western Blot: PRDM9 Antibody [NBP1-80118] - 293T Cell Lysate 1ug/ml Gel Concentration 6-18%](http://images.novusbio.com/fullsize2/PRDM9-Antibody-Western-Blot-NBP1-80118-img0001.jpg)
![Western Blot: NYREN18 Antibody (4H2) [NBP2-03897] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-NYREN18 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).](http://images.novusbio.com/fullsize/NYREN18 Antibody (4H2)-Western Blot-NBP2-03897-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: NYREN18 Antibody (4H2) [NBP2-03897] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY NYREN18.](http://images.novusbio.com/fullsize/NYREN18 Antibody (4H2)-Immunocytochemistry-Immunofluorescence-NBP2-03897-img0006.jpg)
![Immunohistochemistry-Paraffin: NYREN18 Antibody (4H2) [NBP2-03897] - Staining of paraffin-embedded Carcinoma of Human thyroid tissue using anti-NYREN18 mouse monoclonal antibody.](http://images.novusbio.com/fullsize/NYREN18 Antibody (4H2)-Immunohistochemistry-Paraffin-NBP2-03897-img0005.jpg)
![Western Blot: JCAD Antibody [NBP1-90941] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-KIAA1462 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/JCAD-Antibody-Western-Blot-NBP1-90941-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: JCAD Antibody [NBP1-90941] - Staining of human cell line U-2 OS shows localization to cell junctions & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/JCAD-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90941-img0009.jpg)
![Immunohistochemistry-Paraffin: JCAD Antibody [NBP1-90941] - Staining in human cerebral cortex and skin tissues using anti-KIAA1462 antibody. Corresponding KIAA1462 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/JCAD-Antibody-Immunohistochemistry-Paraffin-NBP1-90941-img0012.jpg)
![Western Blot: PDZK1 Antibody [NB400-149] - WB analysis of PDZK1 in fetal human liver lysate.](http://images.novusbio.com/fullsize/PDZK1-Antibody-Western-Blot-NB400-149-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: PDZK1 Antibody [NB400-149] - PDZK1 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).](http://images.novusbio.com/fullsize2/PDZK1-Antibody-Immunocytochemistry-Immunofluorescence-NB400-149-img0004.jpg)
![Immunohistochemistry: PDZK1 Antibody [NB400-149] - IHC analysis of PDZK1 in mouse kidney using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/PDZK1-Antibody-Immunohistochemistry-NB400-149-img0005.jpg)
![Western Blot: REC8 Antibody [NBP1-87145] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/REC8-Antibody-Western-Blot-NBP1-87145-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/REC8 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87145-img0006.jpg)
![Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.](http://images.novusbio.com/fullsize2/REC8-Antibody-Immunohistochemistry-Paraffin-NBP1-87145-img0002.jpg)
![Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.](http://images.novusbio.com/fullsize2/UGCG Antibody (1E5)-Western Blot-H00007357-M03-img0003.jpg)
![Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Detection of UGCG in HT29 human colon carcinoma cells. Image provided courtesy of Dr. James Madigan.](http://images.novusbio.com/fullsize2/UGCG-Antibody-(1E5)-Western-Blot-H00007357-M03-img0001.jpg)
![ELISA: UGCG Antibody (1E5.) [H00007357-M03] - UGCG Antibody (1E5) [H00007357-M03] - Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/UGCG-Antibody-(1E5.)-ELISA-H00007357-M03-img0004.jpg)
![Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.](http://images.novusbio.com/images2/UGCG Antibody (1E5)-Western Blot-H00007357-M03-img0003.jpg "Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.")