RNF186 Antibody (4F10)

Images

 
Western Blot: RNF186 Antibody (4F10) [H00054546-M01] - Detection against Immunogen (34.1 KDa) .
ELISA: RNF186 Antibody (4F10) [H00054546-M01] - Detection limit for recombinant GST tagged RNF186 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-Fr
Clone
4F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF186 Antibody (4F10) Summary

Immunogen
RNF186 (NP_061935, 75 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV
Specificity
RNF186 - ring finger protein 186
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF186
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00054546-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF186 Antibody (4F10)

  • FLJ20225
  • ring finger protein 186
  • RP11-91K11.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-77855
Species: Pm, Ca, Hu, Pm
Applications: B/N, CyTOF-ready, Dual ISH-IHC, EM, ELISA, Flow-CS, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, WB
AF5236
Species: Mu
Applications: WB
DY417
Species: Mu
Applications: ELISA

Publications for RNF186 Antibody (H00054546-M01)(1)


Reviews for RNF186 Antibody (H00054546-M01) (0)

There are no reviews for RNF186 Antibody (H00054546-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF186 Antibody (H00054546-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF186 Products

Array H00054546-M01

Bioinformatics Tool for RNF186 Antibody (H00054546-M01)

Discover related pathways, diseases and genes to RNF186 Antibody (H00054546-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF186 Antibody (H00054546-M01)

Discover more about diseases related to RNF186 Antibody (H00054546-M01).

Blogs on RNF186

There are no specific blogs for RNF186, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF186 Antibody (4F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF186
Entrez
Uniprot