RHBDD2 Antibody

Western Blot: RHBDD2 Antibody [NBP2-47305] - Analysis in control (vector only transfected HEK293T lysate) and RHBDD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: RHBDD2 Antibody [NBP2-47305] - Staining human cell line U-251 MG shows positivity in the golgi apparatus and nucleus but excluded from the nucleoli.

Immunohistochemistry-Paraffin: RHBDD2 Antibody [NBP2-47305] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry: RHBDD2 Antibody [NBP2-47305] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: RHBDD2 Antibody [NBP2-47305] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: RHBDD2 Antibody [NBP2-47305] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: RHBDD2 Antibody [NBP2-47305] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

RHBDD2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ERVALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RHBDD2 Antibody

• H_RG122E10.2a
• H_RG122E10.2b
• rhomboid domain containing 2
• rhomboid domain-containing protein 2
• rhomboid, veinlet-like 7
• veinlet-like 7 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDD2