REEP4 Antibody

Images

 
Western Blot: REEP4 Antibody [NBP1-69521] - This Anti-REEP4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REEP4 Antibody Summary

Immunogen
Synthetic peptides corresponding to REEP4(receptor accessory protein 4) The peptide sequence was selected from the N terminal of REEP4. Peptide sequence EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REEP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against REEP4 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for REEP4 Antibody

  • C8orf20chromosome 8 open reading frame 20
  • FLJ22246
  • FLJ22277
  • PP432
  • receptor accessory protein 4
  • receptor expression enhancing protein 4
  • receptor expression-enhancing protein 4

Background

REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33649
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82952
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45945
Species: Hu
Applications: WB, Flow, IHC
NBP1-86799
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NBP1-77105
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-69521
Species: Hu
Applications: WB

Publications for REEP4 Antibody (NBP1-69521) (0)

There are no publications for REEP4 Antibody (NBP1-69521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REEP4 Antibody (NBP1-69521) (0)

There are no reviews for REEP4 Antibody (NBP1-69521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REEP4 Antibody (NBP1-69521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REEP4 Products

Bioinformatics Tool for REEP4 Antibody (NBP1-69521)

Discover related pathways, diseases and genes to REEP4 Antibody (NBP1-69521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REEP4 Antibody (NBP1-69521)

Discover more about diseases related to REEP4 Antibody (NBP1-69521).
 

Pathways for REEP4 Antibody (NBP1-69521)

View related products by pathway.

PTMs for REEP4 Antibody (NBP1-69521)

Learn more about PTMs related to REEP4 Antibody (NBP1-69521).

Blogs on REEP4

There are no specific blogs for REEP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REEP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REEP4
Uniprot