RD3L Antibody

Images

 
Immunohistochemistry: RD3L Antibody [NBP2-49539] - Staining of human heart muscle shows strong positivity in intercalated discs of myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RD3L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Specificity
Specificity of human RD3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RD3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RD3L Recombinant Protein Antigen (NBP2-49539PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RD3L Antibody

  • Retinal Degeneration 3-Like
  • Retinal Degeneration Protein 3-Like
  • TDRD9 Antisense 1
  • TDRD9 Antisense RNA 1 (Non-Protein Coding)
  • TDRD9AS1
  • TDRD9-AS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RD3L Antibody (NBP2-49539) (0)

There are no publications for RD3L Antibody (NBP2-49539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RD3L Antibody (NBP2-49539) (0)

There are no reviews for RD3L Antibody (NBP2-49539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RD3L Antibody (NBP2-49539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RD3L Products

Array NBP2-49539

Bioinformatics Tool for RD3L Antibody (NBP2-49539)

Discover related pathways, diseases and genes to RD3L Antibody (NBP2-49539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RD3L

There are no specific blogs for RD3L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RD3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RD3L