RAD26L Antibody


Immunocytochemistry/ Immunofluorescence: RAD26L Antibody [NBP3-17300] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

RAD26L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GPPAHKLEMPRQPDCQECRGTEQAAEPLAKEACDLCSDFSDEEPVGATGIKTAKNKAPDSSKASSSPGQLTLLQCGFSKL
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RAD26L Antibody

  • C9orf102
  • chromosome 9 open reading frame 102
  • EC 3.6.1
  • EC 3.6.4.-
  • excision repair cross-complementing rodent repair deficiency, complementation group 6-like 2
  • FLJ37706
  • MGC30192
  • MGC43364
  • putative repair and recombination helicase RAD26L
  • RAD26L
  • SR278
  • stretch responsive protein 278


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAD26L Antibody (NBP3-17300) (0)

There are no publications for RAD26L Antibody (NBP3-17300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD26L Antibody (NBP3-17300) (0)

There are no reviews for RAD26L Antibody (NBP3-17300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAD26L Antibody (NBP3-17300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAD26L Products

Bioinformatics Tool for RAD26L Antibody (NBP3-17300)

Discover related pathways, diseases and genes to RAD26L Antibody (NBP3-17300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RAD26L Antibody (NBP3-17300)

Find related products by research area.

Blogs on RAD26L

There are no specific blogs for RAD26L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAD26L Antibody and receive a gift card or discount.


Gene Symbol ERCC6L2