RABL3 Antibody


Western Blot: RABL3 Antibody [NBP1-81160] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human tonsil shows weak positivity in nuclear membrane in non-germinal center cells.
Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human kidney shows moderate nuclear membrane and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human endometrium shows moderate positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human prostate shows weak to moderate positivity in nuclear membrane in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

RABL3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RABL3 Protein (NBP1-81160PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RABL3 Antibody

  • MGC23920
  • RAB, member of RAS oncogene family-like 3
  • rab-like protein 3


RABL3( AAH20832, 1 a.a. - 237 a.a.) full-length recombinant protein with GST.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RABL3 Antibody (NBP1-81160) (0)

There are no publications for RABL3 Antibody (NBP1-81160).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABL3 Antibody (NBP1-81160) (0)

There are no reviews for RABL3 Antibody (NBP1-81160). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABL3 Antibody (NBP1-81160) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RABL3 Products

Research Areas for RABL3 Antibody (NBP1-81160)

Find related products by research area.

Blogs on RABL3

There are no specific blogs for RABL3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RABL3 Antibody and receive a gift card or discount.


Gene Symbol RABL3