RABL3 Antibody

Western Blot: RABL3 Antibody [NBP1-81160] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human tonsil shows weak positivity in nuclear membrane in non-germinal center cells.

Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human kidney shows moderate nuclear membrane and cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human endometrium shows moderate positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: RABL3 Antibody [NBP1-81160] - Staining of human prostate shows weak to moderate positivity in nuclear membrane in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RABL3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RABL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RABL3 Protein (NBP1-81160PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RABL3 Antibody

• MGC23920
• RAB, member of RAS oncogene family-like 3
• rab-like protein 3

Background

RABL3( AAH20832, 1 a.a. - 237 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RABL3
• Entrez:
  • 285282(Human)
• Uniprot:
  • Q5HYI8(Human)