R3HDM2 Antibody

Images

 
Western Blot: R3HDM2 Antibody [NBP1-81448] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
Immunocytochemistry/ Immunofluorescence: R3HDM2 Antibody [NBP1-81448] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: R3HDM2 Antibody [NBP1-81448] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

R3HDM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YSGVSPSGPGVVVMQLNVPNGPQPPQNPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSP
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
R3HDM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
R3HDM2 Protein (NBP1-81448PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for R3HDM2 Antibody

  • KIAA1002PR01365
  • R3H domain containing 2
  • R3H domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77686
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NB110-40588
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for R3HDM2 Antibody (NBP1-81448) (0)

There are no publications for R3HDM2 Antibody (NBP1-81448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for R3HDM2 Antibody (NBP1-81448) (0)

There are no reviews for R3HDM2 Antibody (NBP1-81448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for R3HDM2 Antibody (NBP1-81448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional R3HDM2 Products

Bioinformatics Tool for R3HDM2 Antibody (NBP1-81448)

Discover related pathways, diseases and genes to R3HDM2 Antibody (NBP1-81448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for R3HDM2 Antibody (NBP1-81448)

View related products by pathway.

Blogs on R3HDM2

There are no specific blogs for R3HDM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our R3HDM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol R3HDM2