PWWP2A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PWWP2A Antibody [NBP2-13833] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PWWP2A Antibody [NBP2-13833] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PWWP2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGA PYPPPLFIRDTYNQSIPQPPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PWWP2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PWWP2A Protein (NBP2-13833PEP)
Publications
Read Publication using NBP2-13833.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PWWP2A Antibody

  • KIAA1935
  • MST101
  • MSTP101
  • PWWP domain containing 2A
  • PWWP domain-containing protein 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PWWP2A Antibody (NBP2-13833)(1)

Reviews for PWWP2A Antibody (NBP2-13833) (0)

There are no reviews for PWWP2A Antibody (NBP2-13833). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PWWP2A Antibody (NBP2-13833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PWWP2A Products

Bioinformatics Tool for PWWP2A Antibody (NBP2-13833)

Discover related pathways, diseases and genes to PWWP2A Antibody (NBP2-13833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PWWP2A

There are no specific blogs for PWWP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PWWP2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PWWP2A