We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTDSS1 Recombinant Protein Antigen

Images

 
There are currently no images for PTDSS1 Protein (NBP1-83060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTDSS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTDSS1.

Source: E. coli

Amino Acid Sequence: AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTDSS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83060.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTDSS1 Recombinant Protein Antigen

  • KIAA0024Serine-exchange enzyme I
  • phosphatidylserine synthase 1
  • PSS1EC 2.7.8.-
  • PSSAPSS-1
  • PtdSer synthase 1

Background

Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS1, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47501
Species: Hu
Applications: IHC,  IHC-P
NBP1-80874
Species: Hu
Applications: IHC,  IHC-P
NBP2-27464
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
4308-SE
Species: Hu
Applications: EnzAct
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
H00026054-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP1-83060PEP
Species: Hu
Applications: AC

Publications for PTDSS1 Protein (NBP1-83060PEP) (0)

There are no publications for PTDSS1 Protein (NBP1-83060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTDSS1 Protein (NBP1-83060PEP) (0)

There are no reviews for PTDSS1 Protein (NBP1-83060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTDSS1 Protein (NBP1-83060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTDSS1 Products

Research Areas for PTDSS1 Protein (NBP1-83060PEP)

Find related products by research area.

Blogs on PTDSS1

There are no specific blogs for PTDSS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTDSS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTDSS1