PRRT4 Antibody

Images

 
Western Blot: PRRT4 Antibody [NBP2-37917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PRRT4 Antibody [NBP2-37917] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm, plasma membrane & peroxisomes.
Immunohistochemistry: PRRT4 Antibody [NBP2-37917] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRT4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
Specificity
Specificity of human PRRT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRRT4 Protein (NBP2-37917PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRT4 Antibody

  • Proline-Rich Transmembrane Protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PRRT4 Antibody (NBP2-37917) (0)

There are no publications for PRRT4 Antibody (NBP2-37917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRT4 Antibody (NBP2-37917) (0)

There are no reviews for PRRT4 Antibody (NBP2-37917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRRT4 Antibody (NBP2-37917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-37917

Bioinformatics Tool for PRRT4 Antibody (NBP2-37917)

Discover related pathways, diseases and genes to PRRT4 Antibody (NBP2-37917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRRT4

There are no specific blogs for PRRT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRT4
Uniprot