We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Prostate and testis expressed protein 3 Antibody - BSA Free

Images

 
Western Blot: Prostate and testis expressed protein 3 Antibody [NBP3-05564] - Western blot analysis of extracts of HeLa cells, using Prostate and testis expressed protein 3 antibody (NBP3-05564). Secondary antibody: HRP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Prostate and testis expressed protein 3 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human Prostate and testis expressed protein 3 (NP_001123355.3). MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Prostate and testis expressed protein 3 Antibody - BSA Free

  • acrosomal vesicle protein HEL-127
  • HEL-127
  • PATE-DJ
  • PATE-like protein DJ
  • secreted TFP/Ly-6/uPAR protein PATE-DJ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prostate and testis expressed protein 3 Antibody (NBP3-05564) (0)

There are no publications for Prostate and testis expressed protein 3 Antibody (NBP3-05564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostate and testis expressed protein 3 Antibody (NBP3-05564) (0)

There are no reviews for Prostate and testis expressed protein 3 Antibody (NBP3-05564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostate and testis expressed protein 3 Antibody (NBP3-05564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prostate and testis expressed protein 3 Products

Blogs on Prostate and testis expressed protein 3

There are no specific blogs for Prostate and testis expressed protein 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostate and testis expressed protein 3 Antibody - BSA Free and receive a gift card or discount.