PROSER2 Antibody


Immunohistochemistry-Paraffin: C10orf47 Antibody [NBP1-93477] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PROSER2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLLRSVPTPLVMAQKISERMAGNEALSPTSPFREGRPGEWRTPAARGPRSGDPG
Specificity of human C10orf47 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PROSER2 Antibody

  • chromosome 10 open reading frame 47
  • hypothetical protein LOC254427


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PROSER2 Antibody (NBP1-93477) (0)

There are no publications for PROSER2 Antibody (NBP1-93477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PROSER2 Antibody (NBP1-93477) (0)

There are no reviews for PROSER2 Antibody (NBP1-93477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PROSER2 Antibody (NBP1-93477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PROSER2 Products

Bioinformatics Tool for PROSER2 Antibody (NBP1-93477)

Discover related pathways, diseases and genes to PROSER2 Antibody (NBP1-93477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PROSER2

There are no specific blogs for PROSER2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PROSER2 Antibody and receive a gift card or discount.


Gene Symbol PROSER2
COVID-19 update