We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Proprotein convertase PC4 Recombinant Protein Antigen

Images

 
There are currently no images for Proprotein convertase PC4 Protein (NBP1-88010PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Proprotein convertase PC4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCSK4.

Source: E. coli

Amino Acid Sequence: ENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PCSK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88010.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proprotein convertase PC4 Recombinant Protein Antigen

  • DKFZp434B217
  • EC 3.4.21
  • EC 3.4.21.75
  • EC 3.4.21.93
  • MGC34749
  • PC4
  • PC4EC 3.4.21.-
  • PCSK4
  • Proprotein convertase 4
  • proprotein convertase subtilisin/kexin type 4
  • SPC5

Background

Proprotein convertase PC4 also known as Proprotein convertase subtilisin/kexin type 4, has 2 isoforms, a 775 amino acid long isoform that is 83 kDa and a short 242 amino acid isoform that is 26 kDa, has placenta tissue specificity and membrane subcellular location, plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor, in transcriptional coactivation, and may be involved in stabilizing the multiprotein transcription complex. Current research is being performed on the following diseases and disorders: dna topoisomerase I, pharyngitis, thyroiditis, and lymphoma. This protein has also shown to have interactions with SOCS1 and IGF2 in biological processes such as proteolysis, binding of sperm to zona pellucida, acrosome reaction, fertilization, and sperm capacitation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP1-51975
Species: Hu
Applications: PEP-ELISA, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-1903
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87326
Species: Hu
Applications: ICC/IF,  IHC-P
NBP3-47196
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15275
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87354
Species: Hu
Applications: IHC,  IHC-P
NBP1-82454
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57153
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-24679
Species: Bv, Ca, Hu, Po, Pm
Applications: IHC,  IHC-P, WB
NBP2-78762
Species: Rt
Applications: ELISA
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Proprotein convertase PC4 Protein (NBP1-88010PEP) (0)

There are no publications for Proprotein convertase PC4 Protein (NBP1-88010PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein convertase PC4 Protein (NBP1-88010PEP) (0)

There are no reviews for Proprotein convertase PC4 Protein (NBP1-88010PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proprotein convertase PC4 Protein (NBP1-88010PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proprotein convertase PC4 Products

Blogs on Proprotein convertase PC4

There are no specific blogs for Proprotein convertase PC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Furin Antibody
NB100-1903

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proprotein convertase PC4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK4