Proline-Rich Basic Protein 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Proline-Rich Basic Protein 1 Antibody [NBP2-49310] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Proline-Rich Basic Protein 1 Antibody [NBP2-49310] - Staining in human skeletal muscle and prostate tissues using anti-PROB1 antibody. Corresponding PROB1 ...read more
Immunohistochemistry-Paraffin: Proline-Rich Basic Protein 1 Antibody [NBP2-49310] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Proline-Rich Basic Protein 1 Antibody [NBP2-49310] - Staining of human skeletal muscle shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Proline-Rich Basic Protein 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proline-Rich Basic Protein 1 Recombinant Protein Antigen (NBP2-49310PEP)

Reactivity Notes

Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proline-Rich Basic Protein 1 Antibody

  • C5orf65
  • Chromosome 5 Open Reading Frame 65
  • PROB1
  • Weakly Similar To Basic Proline-Rich Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Proline-Rich Basic Protein 1 Antibody (NBP2-49310) (0)

There are no publications for Proline-Rich Basic Protein 1 Antibody (NBP2-49310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proline-Rich Basic Protein 1 Antibody (NBP2-49310) (0)

There are no reviews for Proline-Rich Basic Protein 1 Antibody (NBP2-49310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Proline-Rich Basic Protein 1 Antibody (NBP2-49310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proline-Rich Basic Protein 1 Products

Bioinformatics Tool for Proline-Rich Basic Protein 1 Antibody (NBP2-49310)

Discover related pathways, diseases and genes to Proline-Rich Basic Protein 1 Antibody (NBP2-49310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proline-Rich Basic Protein 1 Antibody (NBP2-49310)

Discover more about diseases related to Proline-Rich Basic Protein 1 Antibody (NBP2-49310).

Blogs on Proline-Rich Basic Protein 1

There are no specific blogs for Proline-Rich Basic Protein 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proline-Rich Basic Protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PROB1