PQLC2L Antibody


Immunocytochemistry/ Immunofluorescence: C3orf55 Antibody [NBP2-14781] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus.
Immunohistochemistry-Paraffin: C3orf55 Antibody [NBP2-14781] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile duct cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC

Order Details

PQLC2L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLP
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PQLC2L Recombinant Protein Antigen (NBP2-14781PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PQLC2L Antibody

  • C3orf55 chromosome 3 open reading frame 55


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PQLC2L Antibody (NBP2-14781) (0)

There are no publications for PQLC2L Antibody (NBP2-14781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PQLC2L Antibody (NBP2-14781) (0)

There are no reviews for PQLC2L Antibody (NBP2-14781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PQLC2L Antibody (NBP2-14781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PQLC2L Antibody and receive a gift card or discount.


Gene Symbol C3orf55