PPP1R36 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: PPP1R36 Antibody [NBP2-62718] - Analysis in human testis and endometrium tissues using Anti-PPP1R36 antibody. Corresponding PPP1R36 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PPP1R36 Antibody [NBP2-62718] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PPP1R36 Antibody [NBP2-62718] - Staining of human endometrium shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PPP1R36 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLGLAVPDKHHMCCGKEKISDTQK
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP1R36 Recombinant Protein Antigen (NBP2-62718PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for PPP1R36 Antibody

  • C14orf50
  • chromosome 14 open reading frame 50
  • hypothetical protein LOC145376


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPP1R36 Antibody (NBP2-62718) (0)

There are no publications for PPP1R36 Antibody (NBP2-62718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R36 Antibody (NBP2-62718) (0)

There are no reviews for PPP1R36 Antibody (NBP2-62718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPP1R36 Antibody (NBP2-62718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPP1R36 Products

Bioinformatics Tool for PPP1R36 Antibody (NBP2-62718)

Discover related pathways, diseases and genes to PPP1R36 Antibody (NBP2-62718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PPP1R36

There are no specific blogs for PPP1R36, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP1R36 Antibody and receive a gift card or discount.


Gene Symbol PPP1R36