PNLDC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PNLDC1 Antibody [NBP2-13781] - Staining of human pancreas shows moderate membranous positivity in intercalated ducts.

Immunohistochemistry-Paraffin: PNLDC1 Antibody [NBP2-13781] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PNLDC1 Antibody [NBP2-13781] - Staining of human stomach shows low positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: PNLDC1 Antibody [NBP2-13781] - Staining of human testis shows weak membranous positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PNLDC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PNLDC1 Antibody - BSA Free (NBP2-13781) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNLDC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PNLDC1 Protein (NBP2-13781PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNLDC1 Antibody - BSA Free

• dJ195P10.2
• FLJ40240
• MGC138451
• poly(A)-specific ribonuclease (PARN)-like domain containing 1
• poly(A)-specific ribonuclease PARN-like domain-containing protein 1

Background

PNLDC1, also referred to as Poly(A)-specific ribonuclease PARN-like domain-containing protein 1, has a 520 amino acid long isoform that is approximately 60 kDa and a 531 amino acid isoform that is approximaetly 61 kDa. PNLDC1 is a member of the CAF1 family and localizes to the cell membrane. Current research on PNLDC1 is being conducted in relation to several diseases and disorders including malaria and kidney disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNLDC1