PLSCR5 Antibody


Immunohistochemistry-Paraffin: PLSCR5 Antibody [NBP2-14589] Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PLSCR5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIH VAADLDVT
Specificity of human PLSCR5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLSCR5 Protein (NBP2-14589PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLSCR5 Antibody

  • PLSCR5 phospholipid scramblase family, member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLSCR5 Antibody (NBP2-14589) (0)

There are no publications for PLSCR5 Antibody (NBP2-14589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLSCR5 Antibody (NBP2-14589) (0)

There are no reviews for PLSCR5 Antibody (NBP2-14589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLSCR5 Antibody (NBP2-14589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLSCR5 Products

PLSCR5 NBP2-14589

Bioinformatics Tool for PLSCR5 Antibody (NBP2-14589)

Discover related pathways, diseases and genes to PLSCR5 Antibody (NBP2-14589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLSCR5

There are no specific blogs for PLSCR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLSCR5 Antibody and receive a gift card or discount.


Gene Symbol PLSCR5