PLCXD2 Antibody


Immunocytochemistry/ Immunofluorescence: PLCXD2 Antibody [NBP2-30624] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLCXD2 Antibody [NBP2-30624] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PLCXD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTS
Specificity of human PLCXD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLCXD2 Antibody

  • Phosphatidylinositol-Specific Phospholipase C, X Domain Containing 2
  • PI-PLC X Domain-Containing Protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLCXD2 Antibody (NBP2-30624) (0)

There are no publications for PLCXD2 Antibody (NBP2-30624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCXD2 Antibody (NBP2-30624) (0)

There are no reviews for PLCXD2 Antibody (NBP2-30624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLCXD2 Antibody (NBP2-30624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PLCXD2 Products

Array NBP2-30624

Bioinformatics Tool for PLCXD2 Antibody (NBP2-30624)

Discover related pathways, diseases and genes to PLCXD2 Antibody (NBP2-30624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLCXD2

There are no specific blogs for PLCXD2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLCXD2 Antibody and receive a gift card or discount.


Gene Symbol PLCXD2
Novus 100% Guarantee