PLAC1L Antibody

Images

 
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining of placenta.
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining of liver cancer.
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Staining in human testis and endometrium tissues using anti-OOSP2 antibody. Corresponding OOSP2 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PLAC1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLL
Specificity
Specificity of human PLAC1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAC1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLAC1L Antibody

  • FLJ36198
  • placenta-specific 1-like protein
  • placenta-specific 1-like
  • TMEM122
  • transmembrane protein 122

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLAC1L Antibody (NBP2-33601) (0)

There are no publications for PLAC1L Antibody (NBP2-33601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAC1L Antibody (NBP2-33601) (0)

There are no reviews for PLAC1L Antibody (NBP2-33601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLAC1L Antibody (NBP2-33601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLAC1L Products

Bioinformatics Tool for PLAC1L Antibody (NBP2-33601)

Discover related pathways, diseases and genes to PLAC1L Antibody (NBP2-33601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLAC1L

There are no specific blogs for PLAC1L, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAC1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAC1L
Uniprot
Novus 100% Guarantee