PKHD1L1 Antibody

Product Discontinued

PKHD1L1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DCVDMVCDAKRKSFLRDIDGSFLGNAGSVIPQAEYEWDGNSQVGIGDYRI PKAMLTFLNGSRIPVTEKAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKHD1L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Electron Microscopy
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/Immunofluorescence and Electron Microscopy reported in scientific literature (PMID:31444330).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31444330).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PKHD1L1 Antibody

• DKFZp586C1021
• fibrocystin L
• fibrocystin-L
• PKHD1-like protein 1
• PKHDL1
• polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1
• Polycystic kidney and hepatic disease 1-like protein 1
• polycystic kidney and hepatic disease-like 1

Background

PKHD1L1 - polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PKHD1L1 Antibody (NBP2-13765)(1)

Publication using NBP2-13765

• Wu X, Ivanchenko MV, Al Jandal H et al. PKHD1L1 is a coat protein of hair-cell stereocilia and is required for normal hearing Nat Commun 2019-08-23 [PMID: 31444330] (ICC/IF, EM, KO, Mouse)

Bioinformatics

• Gene Symbol: PKHD1L1