PKHD1L1 Antibody

Images

 
Immunohistochemistry: PKHD1L1 Antibody [NBP2-13765] - Staining of human spleen shows strong nuclear and cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKHD1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DCVDMVCDAKRKSFLRDIDGSFLGNAGSVIPQAEYEWDGNSQVGIGDYRI PKAMLTFLNGSRIPVTEKAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKHD1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PKHD1L1 Protein (NBP2-13765PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKHD1L1 Antibody

  • DKFZp586C1021
  • fibrocystin L
  • fibrocystin-L
  • PKHD1-like protein 1
  • PKHDL1
  • polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1
  • Polycystic kidney and hepatic disease 1-like protein 1
  • polycystic kidney and hepatic disease-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-91561
Species: Hu
Applications: WB
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for PKHD1L1 Antibody (NBP2-13765) (0)

There are no publications for PKHD1L1 Antibody (NBP2-13765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKHD1L1 Antibody (NBP2-13765) (0)

There are no reviews for PKHD1L1 Antibody (NBP2-13765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PKHD1L1 Antibody (NBP2-13765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKHD1L1 Products

Bioinformatics Tool for PKHD1L1 Antibody (NBP2-13765)

Discover related pathways, diseases and genes to PKHD1L1 Antibody (NBP2-13765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PKHD1L1

There are no specific blogs for PKHD1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKHD1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKHD1L1