PDE7B Recombinant Protein Antigen

Images

 
There are currently no images for PDE7B Protein (NBP1-85987PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

PDE7B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE7B.

Source: E. coli

Amino Acid Sequence: QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE7B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85987.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE7B Recombinant Protein Antigen

  • bA472E5.1
  • cAMP-specific 3'-5'-cyclic phosphodiesterase 7B
  • EC 3.1.4
  • EC 3.1.4.17
  • high-affinity cAMP-specific 3'-5'-cyclic phosphodiesterase
  • MGC88256
  • PDE7B
  • phosphodiesterase 7B
  • rolipram-insensitive phosphodiesterase type 7

Background

The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a cAMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-639
Species: Hu, Mu, Rt
Applications: IP, WB
NBP2-15343
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87000
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-12216
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-2462
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, PEP-ELISA, WB
NBP3-12247
Species: Bv, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP3-09985
Species: Hu
Applications: WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for PDE7B Protein (NBP1-85987PEP) (0)

There are no publications for PDE7B Protein (NBP1-85987PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE7B Protein (NBP1-85987PEP) (0)

There are no reviews for PDE7B Protein (NBP1-85987PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDE7B Protein (NBP1-85987PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE7B Products

Bioinformatics Tool for PDE7B Protein (NBP1-85987PEP)

Discover related pathways, diseases and genes to PDE7B Protein (NBP1-85987PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE7B Protein (NBP1-85987PEP)

Discover more about diseases related to PDE7B Protein (NBP1-85987PEP).
 

Pathways for PDE7B Protein (NBP1-85987PEP)

View related products by pathway.

PTMs for PDE7B Protein (NBP1-85987PEP)

Learn more about PTMs related to PDE7B Protein (NBP1-85987PEP).
 

Research Areas for PDE7B Protein (NBP1-85987PEP)

Find related products by research area.

Blogs on PDE7B

There are no specific blogs for PDE7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDE7B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE7B