Recombinant Human PANK4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PANK4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 673-773 of Human PANK4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE

Protein/Peptide Type
Partial Recombinant Protein
Gene
PANK4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PANK4 Protein

  • DKFZp547M242
  • EC 2.7.1.33
  • FLJ10782
  • hPanK4
  • pantothenate kinase 4
  • Pantothenic acid kinase 4

Background

This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. This family member is most abundant in muscle but is expressed in all tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32509
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03298
Species: Hu
Applications: WB, Flow
NBP2-38967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-81765
Species: Hu
Applications: IHC, IHC-P

Publications for PANK4 Partial Recombinant Protein (H00055229-Q01) (0)

There are no publications for PANK4 Partial Recombinant Protein (H00055229-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PANK4 Partial Recombinant Protein (H00055229-Q01) (0)

There are no reviews for PANK4 Partial Recombinant Protein (H00055229-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PANK4 Partial Recombinant Protein (H00055229-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PANK4 Products

Bioinformatics Tool for PANK4 Partial Recombinant Protein (H00055229-Q01)

Discover related pathways, diseases and genes to PANK4 Partial Recombinant Protein (H00055229-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PANK4 Partial Recombinant Protein (H00055229-Q01)

Discover more about diseases related to PANK4 Partial Recombinant Protein (H00055229-Q01).

Blogs on PANK4

There are no specific blogs for PANK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PANK4 Antibody
H00055229-D01P
PKM2 Antibody
NBP1-48308

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PANK4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PANK4