OR5P3 Antibody


Western Blot: OR5P3 Antibody [NBP2-83332] - Host: Rabbit. Target Name: OR5P3. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

OR5P3 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5P3. Peptide sequence: IYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGALKRELRI The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (93%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for OR5P3 Antibody

  • JCG1
  • olfactory receptor 5P3
  • Olfactory receptor OR11-94
  • olfactory receptor, family 5, subfamily P, member 3
  • Olfactory receptor-like protein JCG1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for OR5P3 Antibody (NBP2-83332) (0)

There are no publications for OR5P3 Antibody (NBP2-83332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR5P3 Antibody (NBP2-83332) (0)

There are no reviews for OR5P3 Antibody (NBP2-83332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR5P3 Antibody (NBP2-83332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional OR5P3 Products

Bioinformatics Tool for OR5P3 Antibody (NBP2-83332)

Discover related pathways, diseases and genes to OR5P3 Antibody (NBP2-83332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR5P3

There are no specific blogs for OR5P3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OR5P3 Antibody and receive a gift card or discount.


Gene Symbol OR5P3