OR8B8 Antibody

Images

 
Western Blot: OR8B8 Antibody [H00026493-B01P] - Analysis of OR8B8 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: OR8B8 Antibody [H00026493-B01P] - Analysis of purified antibody to OR8B8 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: OR8B8 Antibody [H00026493-B01P] - Analysis of OR8B8 expression in transfected 293T cell line by OR8B8 polyclonal antibody. Lane 1: OR8B8 transfected lysate(34.50 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OR8B8 Antibody Summary

Immunogen
OR8B8 (NP_036510.1, 1 a.a. - 311 a.a.) full-length human protein. MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVALKKILNKNAFS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
OR8B8
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OR8B8 Antibody

  • olfactory receptor 8B8
  • olfactory receptor OR11-316
  • Olfactory receptor TPCR85
  • olfactory receptor, family 8, subfamily B, member 8
  • Olfactory-like receptor JCG8
  • TPCR85

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00120065-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-09845
Species: Hu
Applications: WB
H00283159-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00026659-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00283160-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-09660
Species: Hu
Applications: WB
H00120066-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-13714
Species: Hu
Applications: IHC, IHC-P

Publications for OR8B8 Antibody (H00026493-B01P) (0)

There are no publications for OR8B8 Antibody (H00026493-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR8B8 Antibody (H00026493-B01P) (0)

There are no reviews for OR8B8 Antibody (H00026493-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OR8B8 Antibody (H00026493-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OR8B8 Products

Array H00026493-B01P

Bioinformatics Tool for OR8B8 Antibody (H00026493-B01P)

Discover related pathways, diseases and genes to OR8B8 Antibody (H00026493-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR8B8

There are no specific blogs for OR8B8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR8B8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OR8B8
Uniprot