OR8B8 Antibody - Azide and BSA Free

Western Blot: OR8B8 Antibody [H00026493-B01P] - Analysis of OR8B8 expression in Jurkat.

Immunocytochemistry/Immunofluorescence: OR8B8 Antibody [H00026493-B01P] - Analysis of purified antibody to OR8B8 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: OR8B8 Antibody [H00026493-B01P] - Analysis of OR8B8 expression in transfected 293T cell line by OR8B8 polyclonal antibody. Lane 1: OR8B8 transfected lysate(34.50 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OR8B8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse OR8B8 Antibody - Azide and BSA Free (H00026493-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: OR8B8 (NP_036510.1, 1 a.a. - 311 a.a.) full-length human protein. MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVALKKILNKNAFS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: OR8B8
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OR8B8 Antibody - Azide and BSA Free

• olfactory receptor 8B8
• olfactory receptor OR11-316
• Olfactory receptor TPCR85
• olfactory receptor, family 8, subfamily B, member 8
• Olfactory-like receptor JCG8
• TPCR85

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR8B8
• Uniprot:
  • NP_036510.1(Human)