OR51B5 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51B5. Peptide sequence: PAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCVSHICCV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OR51B5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for OR51B5 Antibody - BSA Free
Background
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers theperception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors(GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with manyneurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction ofodorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to theolfactory receptor genes and proteins for this organism is independent of other organisms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, Flow, GS, IP, WB
Species: Hu
Applications: WB
Publications for OR51B5 Antibody (NBP2-83322) (0)
There are no publications for OR51B5 Antibody (NBP2-83322).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OR51B5 Antibody (NBP2-83322) (0)
There are no reviews for OR51B5 Antibody (NBP2-83322).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OR51B5 Antibody (NBP2-83322) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OR51B5 Products
Blogs on OR51B5