OLT-2 Antibody


Western Blot: OLT-2 Antibody [NBP2-30759] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: OLT-2 Antibody [NBP2-30759] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

OLT-2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LFVPIMFALLKAGTPSPIQLQSPAGKEIDFSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Control Peptide
OLT-2 Protein (NBP2-30759PEP)

Alternate Names for OLT-2 Antibody

  • OSCAR-Like Transcript-2 Protein
  • T Cell-Interacting, Activating Receptor On Myeloid Cells 1
  • T Cell-Interacting, Activating Receptor On Myeloid Cells
  • TARM1
  • T-Cell-Interacting, Activating Receptor On Myeloid Cells Protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OLT-2 Antibody (NBP2-30759) (0)

There are no publications for OLT-2 Antibody (NBP2-30759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLT-2 Antibody (NBP2-30759) (0)

There are no reviews for OLT-2 Antibody (NBP2-30759). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OLT-2 Antibody (NBP2-30759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OLT-2 Antibody Products

OLT-2 NBP2-30759

Bioinformatics Tool for OLT-2 Antibody (NBP2-30759)

Discover related pathways, diseases and genes to OLT-2 Antibody (NBP2-30759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OLT-2

There are no specific blogs for OLT-2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol TARM1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-30759 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought