OLT-2 Antibody


Western Blot: OLT-2 Antibody [NBP2-30759] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: OLT-2 Antibody [NBP2-30759] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

OLT-2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LFVPIMFALLKAGTPSPIQLQSPAGKEIDFSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGN
Specificity of human OLT-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OLT-2 Protein (NBP2-30759PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OLT-2 Antibody

  • OLT2
  • OLT-2/TARM1
  • OSCAR-Like Transcript-2 Protein
  • T Cell-Interacting, Activating Receptor On Myeloid Cells 1
  • T Cell-Interacting, Activating Receptor On Myeloid Cells
  • TARM1
  • T-Cell-Interacting, Activating Receptor On Myeloid Cells Protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OLT-2 Antibody (NBP2-30759) (0)

There are no publications for OLT-2 Antibody (NBP2-30759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLT-2 Antibody (NBP2-30759) (0)

There are no reviews for OLT-2 Antibody (NBP2-30759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OLT-2 Antibody (NBP2-30759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OLT-2 Products

OLT-2 NBP2-30759

Bioinformatics Tool for OLT-2 Antibody (NBP2-30759)

Discover related pathways, diseases and genes to OLT-2 Antibody (NBP2-30759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OLT-2

There are no specific blogs for OLT-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OLT-2 Antibody and receive a gift card or discount.


Gene Symbol TARM1