Odontogenesis associated phosphoprotein Antibody

Images

 
Western Blot: Odontogenesis associated phosphoprotein Antibody [NBP3-09653] - Western blot analysis of Odontogenesis associated phosphoprotein in HT1080 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Odontogenesis associated phosphoprotein Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C4orf26 (NP_848592). Peptide sequence MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTP
Clonality
Polyclonal
Host
Rabbit
Gene
ODAPH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Odontogenesis associated phosphoprotein Antibody

  • AI2A4
  • C4orf26
  • ODAPH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-09653
Species: Hu
Applications: WB

Publications for Odontogenesis associated phosphoprotein Antibody (NBP3-09653) (0)

There are no publications for Odontogenesis associated phosphoprotein Antibody (NBP3-09653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Odontogenesis associated phosphoprotein Antibody (NBP3-09653) (0)

There are no reviews for Odontogenesis associated phosphoprotein Antibody (NBP3-09653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Odontogenesis associated phosphoprotein Antibody (NBP3-09653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Odontogenesis associated phosphoprotein Products

Bioinformatics Tool for Odontogenesis associated phosphoprotein Antibody (NBP3-09653)

Discover related pathways, diseases and genes to Odontogenesis associated phosphoprotein Antibody (NBP3-09653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Odontogenesis associated phosphoprotein Antibody (NBP3-09653)

Discover more about diseases related to Odontogenesis associated phosphoprotein Antibody (NBP3-09653).
 

Pathways for Odontogenesis associated phosphoprotein Antibody (NBP3-09653)

View related products by pathway.

Blogs on Odontogenesis associated phosphoprotein

There are no specific blogs for Odontogenesis associated phosphoprotein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Odontogenesis associated phosphoprotein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ODAPH