C4orf48 Antibody


Immunocytochemistry/ Immunofluorescence: C4orf48 Antibody [NBP2-30706] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

C4orf48 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C4orf48 Protein (NBP2-30706PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C4orf48 Antibody

  • CHR4_55
  • Chromosome 4 Open Reading Frame 48
  • Neuropeptide-Like Protein C4orf48


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C4orf48 Antibody (NBP2-30706) (0)

There are no publications for C4orf48 Antibody (NBP2-30706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4orf48 Antibody (NBP2-30706) (0)

There are no reviews for C4orf48 Antibody (NBP2-30706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C4orf48 Antibody (NBP2-30706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C4orf48 Products

C4orf48 NBP2-30706

Bioinformatics Tool for C4orf48 Antibody (NBP2-30706)

Discover related pathways, diseases and genes to C4orf48 Antibody (NBP2-30706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C4orf48 Antibody (NBP2-30706)

Discover more about diseases related to C4orf48 Antibody (NBP2-30706).

Pathways for C4orf48 Antibody (NBP2-30706)

View related products by pathway.

PTMs for C4orf48 Antibody (NBP2-30706)

Learn more about PTMs related to C4orf48 Antibody (NBP2-30706).

Blogs on C4orf48

There are no specific blogs for C4orf48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C4orf48 Antibody and receive a gift card or discount.


Gene Symbol C4orf48