![Immunocytochemistry/Immunofluorescence: C4orf48 Antibody [NBP2-30706] - Staining of human cell line PC-3 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/C4orf48-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30706-img0002.jpg "Immunocytochemistry/Immunofluorescence: C4orf48 Antibody [NBP2-30706] - Staining of human cell line PC-3 shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWP |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C4orf48 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for C4orf48 Antibody (NBP2-30706)Discover more about diseases related to C4orf48 Antibody (NBP2-30706).
| Pathways for C4orf48 Antibody (NBP2-30706)View related products by pathway.
|
PTMs for C4orf48 Antibody (NBP2-30706)Learn more about PTMs related to C4orf48 Antibody (NBP2-30706).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/C4orf48-Antibody-Immunohistochemistry-Paraffin-NBP2-30706-img0007.jpg "Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize2/C4orf48-Antibody-Immunohistochemistry-Paraffin-NBP2-30706-img0004.jpg "Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human skin shows moderate cytoplasmic positivity in Langerhans cells.](http://images.novusbio.com/fullsize2/C4orf48-Antibody-Immunohistochemistry-Paraffin-NBP2-30706-img0005.jpg "Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human skin shows moderate cytoplasmic positivity in Langerhans cells.")
![Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/C4orf48-Antibody-Immunohistochemistry-Paraffin-NBP2-30706-img0006.jpg "Immunohistochemistry-Paraffin: C4orf48 Antibody [NBP2-30706] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")