NT5DC4 Antibody

Images

 
Immunohistochemistry-Paraffin: NT5DC4 Antibody [NBP2-14580] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5DC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQAN LDPASCLLSCNQRSLPAKSCLSSAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5DC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NT5DC4 Protein (NBP2-14580PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NT5DC4 Antibody

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NT5DC4 Antibody (NBP2-14580) (0)

There are no publications for NT5DC4 Antibody (NBP2-14580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5DC4 Antibody (NBP2-14580) (0)

There are no reviews for NT5DC4 Antibody (NBP2-14580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NT5DC4 Antibody (NBP2-14580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5DC4 Products

NT5DC4 NBP2-14580

Bioinformatics Tool for NT5DC4 Antibody (NBP2-14580)

Discover related pathways, diseases and genes to NT5DC4 Antibody (NBP2-14580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NT5DC4

There are no specific blogs for NT5DC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5DC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5DC4