Recombinant Human NMNAT3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NMNAT3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 215 of Human NMNAT3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NMNAT3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NMNAT3 Protein

  • EC 2.7.7.1
  • EC 2.7.7.18
  • NaMN adenylyltransferase 3
  • nicotinamide mononucleotide adenylyltransferase 3
  • nicotinamide nucleotide adenylyltransferase 3
  • Nicotinate-nucleotide adenylyltransferase 3
  • PNAT-3
  • PNAT3NMN adenylyltransferase 3
  • Pyridine nucleotide adenylyltransferase 3

Background

The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064802-B01P
Species: Hu, Ha
Applications: WB, ELISA, ICC/IF
H00023057-M02
Species: Hu
Applications: WB, ELISA
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-86057
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5480
Species: Hu
Applications: IHC
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-38640
Species: Hu
Applications: IHC, IHC-P
NBP2-13285
Species: Hu
Applications: IHC, IHC-P
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
NBP2-58328
Species: Hu
Applications: ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NMNAT3 Recombinant Protein (H00349565-P01) (0)

There are no publications for NMNAT3 Recombinant Protein (H00349565-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMNAT3 Recombinant Protein (H00349565-P01) (0)

There are no reviews for NMNAT3 Recombinant Protein (H00349565-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMNAT3 Recombinant Protein (H00349565-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NMNAT3 Products

Bioinformatics Tool for NMNAT3 Recombinant Protein (H00349565-P01)

Discover related pathways, diseases and genes to NMNAT3 Recombinant Protein (H00349565-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT3 Recombinant Protein (H00349565-P01)

Discover more about diseases related to NMNAT3 Recombinant Protein (H00349565-P01).
 

Pathways for NMNAT3 Recombinant Protein (H00349565-P01)

View related products by pathway.

PTMs for NMNAT3 Recombinant Protein (H00349565-P01)

Learn more about PTMs related to NMNAT3 Recombinant Protein (H00349565-P01).

Blogs on NMNAT3

There are no specific blogs for NMNAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NMNAT3 Antibody
NBP2-27543

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NMNAT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NMNAT3