| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPG |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NHLRC2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-85019 | Applications | Species |
|---|---|---|
| Boschann F, Sczakiel H, Zhao M et al FINCA syndrome beyond pulmonary affection: biallelic NHLRC2 variants in eight families with intellectual disability and epilepsy Research Square 2022-11-11 (WB, Human) | WB | Human |
| Hiltunen AE, Vuolteenaho R, Ronkainen VP et al. Nhlrc2 is crucial during mouse gastrulation genesis 2022-03-01 [PMID: 35258166] (WB, Mouse) | WB | Mouse |
| Anniina E. Hiltunen, Salla M. Kangas, Steffen Ohlmeier, Ilkka Pietilä, Jori Hiltunen, Heikki Tanila, Colin McKerlie, Subashika Govindan, Hannu Tuominen, Riitta Kaarteenaho, Mikko Hallman, Johanna Uusimaa, Reetta Hinttala Variant in NHLRC2 leads to increased hnRNP C2 in developing neurons and the hippocampus of a mouse model of FINCA disease Molecular Medicine 2020-12-09 [PMID: 33297935] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NHLRC2 |