![Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NHLRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-85019-img0005.jpg "Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit NHLRC2 Antibody - BSA Free (NBP1-85019) is a polyclonal antibody validated for use in IHC and WB. Anti-NHLRC2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPG |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NHLRC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-85019 | Applications | Species |
|---|---|---|
| Boschann F, Sczakiel H, Zhao M et al FINCA syndrome beyond pulmonary affection: biallelic NHLRC2 variants in eight families with intellectual disability and epilepsy Research Square 2022-11-11 (WB, Human) | WB | Human |
| Hiltunen AE, Vuolteenaho R, Ronkainen VP et al. Nhlrc2 is crucial during mouse gastrulation genesis 2022-03-01 [PMID: 35258166] (WB, Mouse) | WB | Mouse |
| Anniina E. Hiltunen, Salla M. Kangas, Steffen Ohlmeier, Ilkka Pietilä, Jori Hiltunen, Heikki Tanila, Colin McKerlie, Subashika Govindan, Hannu Tuominen, Riitta Kaarteenaho, Mikko Hallman, Johanna Uusimaa, Reetta Hinttala Variant in NHLRC2 leads to increased hnRNP C2 in developing neurons and the hippocampus of a mouse model of FINCA disease Molecular Medicine 2020-12-09 [PMID: 33297935] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NHLRC2 |
![Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NHLRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-85019-img0003.jpg "Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/NHLRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-85019-img0004.jpg "Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/NHLRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-85019-img0006.jpg "Immunohistochemistry-Paraffin: NHLRC2 Antibody [NBP1-85019] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")