NEPRO Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C3orf17 Antibody [NBP2-57440] - Staining of human cell line HaCaT shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEPRO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLG
Specificity
Specificity of human C3orf17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C3ORF17
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEPRO Recombinant Protein Antigen (NBP2-57440PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NEPRO Antibody

  • C3orf17
  • chromosome 3 open reading frame 17
  • DKFZP434F2021
  • hypothetical protein LOC25871
  • NET17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEPRO Antibody (NBP2-57440) (0)

There are no publications for NEPRO Antibody (NBP2-57440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEPRO Antibody (NBP2-57440) (0)

There are no reviews for NEPRO Antibody (NBP2-57440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEPRO Antibody (NBP2-57440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEPRO Products

Bioinformatics Tool for NEPRO Antibody (NBP2-57440)

Discover related pathways, diseases and genes to NEPRO Antibody (NBP2-57440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NEPRO

There are no specific blogs for NEPRO, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEPRO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C3ORF17