NEK5 Antibody

Images

 
Immunohistochemistry-Paraffin: NEK5 Antibody [NBP2-48737] - Staining of human prostate shows low expression as expected.
Immunohistochemistry: NEK5 Antibody [NBP2-48737] - Staining of human testis shows moderate nuclear and weak cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NEK5 Antibody [NBP2-48737] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: NEK5 Antibody [NBP2-48737] - Staining in human fallopian tube and prostate tissues using anti-NEK5 antibody. Corresponding NEK5 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEK5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
Specificity
Specificity of human NEK5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEK5 Recombinant Protein Antigen (NBP2-48737PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEK5 Antibody

  • never in mitosis A-related kinase 5
  • NIMA (never in mitosis gene a)-related kinase 5
  • nimA-related protein kinase 5
  • serine/threonine-protein kinase Nek5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-64735
Species: Hu
NBP2-48737
Species: Hu
Applications: IHC, IHC-P

Publications for NEK5 Antibody (NBP2-48737) (0)

There are no publications for NEK5 Antibody (NBP2-48737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK5 Antibody (NBP2-48737) (0)

There are no reviews for NEK5 Antibody (NBP2-48737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NEK5 Antibody (NBP2-48737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NEK5 Antibody (NBP2-48737)

Discover related pathways, diseases and genes to NEK5 Antibody (NBP2-48737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK5 Antibody (NBP2-48737)

Discover more about diseases related to NEK5 Antibody (NBP2-48737).
 

Pathways for NEK5 Antibody (NBP2-48737)

View related products by pathway.

PTMs for NEK5 Antibody (NBP2-48737)

Learn more about PTMs related to NEK5 Antibody (NBP2-48737).
 

Research Areas for NEK5 Antibody (NBP2-48737)

Find related products by research area.

Blogs on NEK5

There are no specific blogs for NEK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK5