NECAP2 Antibody

Images

 
Western Blot: NECAP2 Antibody [NBP1-57626] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NECAP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NECAP2(NECAP endocytosis associated 2) The peptide sequence was selected from the N terminal of NECAP2. Peptide sequence WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NECAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NECAP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NECAP2 Antibody

  • adaptin ear-binding coat-associated protein 2
  • adaptin-ear-binding coat-associated protein 2
  • FLJ10420
  • NECAP endocytosis associated 2
  • NECAP endocytosis-associated protein 2
  • NECAP-2

Background

This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38022
Species: Hu
Applications: IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for NECAP2 Antibody (NBP1-57626) (0)

There are no publications for NECAP2 Antibody (NBP1-57626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAP2 Antibody (NBP1-57626) (0)

There are no reviews for NECAP2 Antibody (NBP1-57626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NECAP2 Antibody (NBP1-57626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NECAP2 Products

Bioinformatics Tool for NECAP2 Antibody (NBP1-57626)

Discover related pathways, diseases and genes to NECAP2 Antibody (NBP1-57626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NECAP2 Antibody (NBP1-57626)

View related products by pathway.

Blogs on NECAP2

There are no specific blogs for NECAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NECAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NECAP2
Uniprot