MYLK4 Antibody

Images

 
Immunohistochemistry-Paraffin: MYLK4 Antibody [NBP1-80761] - Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYLK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYLK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYLK4 Protein (NBP1-80761PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYLK4 Antibody

  • caMLCK like
  • EC 2.7.11
  • EC 2.7.11.1
  • MYLK4
  • myosin light chain kinase family, member 4
  • SgK085
  • SgK085myosin light chain kinase family member 4
  • Sugen kinase 85

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80761
Species: Hu
Applications: IHC, IHC-P

Publications for MYLK4 Antibody (NBP1-80761) (0)

There are no publications for MYLK4 Antibody (NBP1-80761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYLK4 Antibody (NBP1-80761) (0)

There are no reviews for MYLK4 Antibody (NBP1-80761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYLK4 Antibody (NBP1-80761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYLK4 Products

Bioinformatics Tool for MYLK4 Antibody (NBP1-80761)

Discover related pathways, diseases and genes to MYLK4 Antibody (NBP1-80761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK4 Antibody (NBP1-80761)

Discover more about diseases related to MYLK4 Antibody (NBP1-80761).

Research Areas for MYLK4 Antibody (NBP1-80761)

Find related products by research area.

Blogs on MYLK4

There are no specific blogs for MYLK4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYLK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYLK4
Entrez