MRPS5 Antibody


Western Blot: MRPS5 Antibody [NBP2-47367] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MRPS5 Antibody [NBP2-47367] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPS5 Antibody [NBP2-47367] - Analysis of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MRPS5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS5 Protein (NBP2-47367PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS5 Antibody

  • mitochondrial 28S ribosomal protein S5
  • mitochondrial ribosomal protein S5
  • MRP-S5S5mt28S ribosomal protein S5, mitochondrial


MRPS5, or Mitochondrial Ribosomal Protein S5, contains a long 48 kDa isoform and a short 28 kDa isoform, and is involved in protein synthesis as a component of the 28S small mitochondrial ribosome subunit. Current research is being conducted on MRPS5 and its relation to several diseases and disorders, including mycobacterium tuberculosis, pneumonia, and tuberculosis. The protein interacts with MRPS2, ICT1, ESR2, DDX56, and AGO1, and has been associated with the process of translation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS5 Antibody (NBP2-47367) (0)

There are no publications for MRPS5 Antibody (NBP2-47367).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS5 Antibody (NBP2-47367) (0)

There are no reviews for MRPS5 Antibody (NBP2-47367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS5 Antibody (NBP2-47367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPS5 Products

Bioinformatics Tool for MRPS5 Antibody (NBP2-47367)

Discover related pathways, diseases and genes to MRPS5 Antibody (NBP2-47367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MRPS5

There are no specific blogs for MRPS5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS5 Antibody and receive a gift card or discount.


Gene Symbol MRPS5