We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MRPS26 Antibody - BSA Free

Images

 
Western Blot: MRPS26 Antibody [NBP1-92141] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MRPS26 Antibody [NBP1-92141] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPS26 Antibody [NBP1-92141] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MRPS26 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS26
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS26 Protein (NBP1-92141PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRPS26 Antibody - BSA Free

  • C20orf193
  • dJ534B8.3
  • GI008,28S ribosomal protein S13, mitochondrial
  • mitochondrial ribosomal protein S26
  • MRP-S13MRPS13
  • MRP-S26chromosome 20 open reading frame 193
  • NY-BR-87
  • RPMS1328S ribosomal protein S26, mitochondrial
  • S13mt
  • S26mt
  • serologically defined breast cancer antigen NY-BR-87

Background

MRPS26, also known as Mitochondrial Ribosomal Protein S26, consists of a 205 amino acid isoform that is 24 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. Current research is currently being conducted on the between MRPS26 and a variety of diseases and disorders, including Dubin-Johnson syndrome, gout, and breast cancer. MRPS26 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several proteins, such as ICT1, PPP2CA, USP42, LMNA, and KBTBD7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86515
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-92141
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for MRPS26 Antibody (NBP1-92141) (0)

There are no publications for MRPS26 Antibody (NBP1-92141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS26 Antibody (NBP1-92141) (0)

There are no reviews for MRPS26 Antibody (NBP1-92141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS26 Antibody (NBP1-92141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS26 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS26