MRPS21 Antibody (1C5) - Azide and BSA Free

Sandwich ELISA: MRPS21 Antibody (1C5) [H00054460-M03] - Detection limit for recombinant GST tagged MRPS21 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1C5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPS21 Antibody (1C5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MRPS21 Antibody (1C5) - Azide and BSA Free (H00054460-M03) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MRPS21 (AAH04566, 1 a.a. ~ 87 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
• Specificity: Reacts with mitochondrial ribosomal protein S21.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MRPS21
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS21 Antibody (1C5) - Azide and BSA Free

• 28S ribosomal protein S21, mitochondrial
• mitochondrial 28S ribosomal protein S21
• mitochondrial ribosomal protein S21
• MRP-S21
• RPMS21
• S21mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS21
• Entrez:
  • 54460(Human)
• Uniprot:
  • AAH04566(Human)