MRPS15 Antibody


Immunohistochemistry-Paraffin: MRPS15 Antibody [NBP1-87400] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: MRPS15 Antibody [NBP1-87400] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS15 Antibody [NBP1-87400] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS15 Antibody [NBP1-87400] - Staining in human testis and pancreas tissues using anti-MRPS15 antibody. Corresponding MRPS15 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MRPS15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKE
Specificity of human MRPS15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS15 Protein (NBP1-87400PEP)
Read Publication using
NBP1-87400 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS15 Antibody

  • FLJ11564,28S ribosomal protein S15, mitochondrial
  • mitochondrial ribosomal protein S15
  • MPR-S15
  • MRP-S15
  • RPMS15
  • S15mt


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS15 Antibody (NBP1-87400)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MRPS15 Antibody (NBP1-87400) (0)

There are no reviews for MRPS15 Antibody (NBP1-87400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPS15 Antibody (NBP1-87400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPS15 Products

Bioinformatics Tool for MRPS15 Antibody (NBP1-87400)

Discover related pathways, diseases and genes to MRPS15 Antibody (NBP1-87400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MRPS15

There are no specific blogs for MRPS15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS15 Antibody and receive a gift card or discount.


Gene Symbol MRPS15