MRPL54 Antibody


Immunohistochemistry-Paraffin: MRPL54 Antibody [NBP2-48761] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MRPL54 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVC
Specificity of human MRPL54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL54 Recombinant Protein Antigen (NBP2-48761PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPL54 Antibody

  • L54mt
  • mitochondrial ribosomal protein L54
  • MRP-L54,39S ribosomal protein L54, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL54 Antibody (NBP2-48761) (0)

There are no publications for MRPL54 Antibody (NBP2-48761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL54 Antibody (NBP2-48761) (0)

There are no reviews for MRPL54 Antibody (NBP2-48761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPL54 Antibody (NBP2-48761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MRPL54 Antibody (NBP2-48761)

Discover related pathways, diseases and genes to MRPL54 Antibody (NBP2-48761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MRPL54

There are no specific blogs for MRPL54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPL54 Antibody and receive a gift card or discount.


Gene Symbol MRPL54