MRPL54 Antibody

Images

 
Western Blot: MRPL54 Antibody [NBP2-47368] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: MRPL54 Antibody [NBP2-47368] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL54 Antibody [NBP2-47368] - Staining of human fallopian tube shows cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL54 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL54
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL54 Protein (NBP2-47368PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL54 Antibody

  • L54mt
  • mitochondrial ribosomal protein L54
  • MRP-L54,39S ribosomal protein L54, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL54 Antibody (NBP2-47368) (0)

There are no publications for MRPL54 Antibody (NBP2-47368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL54 Antibody (NBP2-47368) (0)

There are no reviews for MRPL54 Antibody (NBP2-47368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL54 Antibody (NBP2-47368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL54 Products

Bioinformatics Tool for MRPL54 Antibody (NBP2-47368)

Discover related pathways, diseases and genes to MRPL54 Antibody (NBP2-47368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MRPL54

There are no specific blogs for MRPL54, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL54