MORN1 Antibody (NBP2-49643)

Images

 
Immunohistochemistry: MORN1 Antibody [NBP2-49643] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MORN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:SGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MORN1 Antibody

  • MORN repeat containing 1
  • MORN repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MORN1 Antibody (NBP2-49643) (0)

There are no publications for MORN1 Antibody (NBP2-49643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORN1 Antibody (NBP2-49643) (0)

There are no reviews for MORN1 Antibody (NBP2-49643). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for MORN1 Antibody (NBP2-49643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MORN1 Products

MORN1 NBP2-49643

Related Products by Gene

Bioinformatics Tool for MORN1 Antibody (NBP2-49643)

Discover related pathways, diseases and genes to MORN1 Antibody (NBP2-49643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORN1 Antibody (NBP2-49643)

Discover more about diseases related to MORN1 Antibody (NBP2-49643).
 

Pathways for MORN1 Antibody (NBP2-49643)

View related products by pathway.

Blogs on MORN1

There are no specific blogs for MORN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MORN1