Mitochondrial Ribosomal Protein S18C Antibody

Images

 
Immunohistochemistry-Paraffin: Mitochondrial Ribosomal Protein S18C Antibody [NBP2-14807] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mitochondrial Ribosomal Protein S18C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS18C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mitochondrial Ribosomal Protein S18C Protein (NBP2-14807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mitochondrial Ribosomal Protein S18C Antibody

  • 28S ribosomal protein S18c, mitochondrial
  • CGI-134
  • mitochondrial ribosomal protein S18-1
  • mitochondrial ribosomal protein S18C
  • MRP-S18-1
  • MRPS18-1
  • MRPS18-1mitochondrial
  • MRPS18C mitochondrial ribosomal protein S18C
  • MRP-S18-c
  • mrps18-c
  • S18mt-c

Background

MRPS18C, also known as 28 S ribosomal protein S18c, mitochondrial, is a 15.9 kDa, 142 amino acid protein that is utilized in the 28S ribosome subunit located in the mitochondria. Currently, there is no research linking the protein to any diseases. The protein interacts with MRPL42 in translation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Mitochondrial Ribosomal Protein S18C Antibody (NBP2-14807) (0)

There are no publications for Mitochondrial Ribosomal Protein S18C Antibody (NBP2-14807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mitochondrial Ribosomal Protein S18C Antibody (NBP2-14807) (0)

There are no reviews for Mitochondrial Ribosomal Protein S18C Antibody (NBP2-14807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mitochondrial Ribosomal Protein S18C Antibody (NBP2-14807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mitochondrial Ribosomal Protein S18C Products

Blogs on Mitochondrial Ribosomal Protein S18C

There are no specific blogs for Mitochondrial Ribosomal Protein S18C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mitochondrial Ribosomal Protein S18C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS18C