MINOS1 Antibody

Images

 
Western Blot: MINOS1 Antibody [NBP1-91587] - Host: Rabbit. Target Name: MINOS1. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1ug/ml
Western Blot: MINOS1 Antibody [NBP1-91587] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: MINOS1 Antibody [NBP1-91587] - Host: Rabbit. Target Name: MINOS1. Sample Tissue: Human COLO205 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MINOS1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human C1orf151. Peptide sequence IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MINOS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C1orf151 and was validated on Western blot.
Publications
Read Publication using
NBP1-91587 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MINOS1 Antibody

  • mitochondrial inner membrane organizing system 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1919
Species: Hu, Mu, Rt, Ca, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MINOS1 Antibody (NBP1-91587)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MINOS1 Antibody (NBP1-91587) (0)

There are no reviews for MINOS1 Antibody (NBP1-91587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MINOS1 Antibody (NBP1-91587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MINOS1 Products

Bioinformatics Tool for MINOS1 Antibody (NBP1-91587)

Discover related pathways, diseases and genes to MINOS1 Antibody (NBP1-91587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MINOS1 Antibody (NBP1-91587)

View related products by pathway.

Blogs on MINOS1.

Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS)
Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MINOS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MINOS1
Uniprot