Recombinant Human MEX3D Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MEX3D Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 418 - 488 of Human RKHD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIRVETETPQPGGASALQRQY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MEX3D

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MEX3D Protein

  • KIAA2031Tino
  • mex-3 homolog D (C. elegans)
  • OK/SW-cl.4
  • ring finger (C3HC4 type) and KH domain containing 1
  • ring finger and KH domain containing 1
  • RING finger and KH domain-containing protein 1
  • RING finger protein 193
  • RKHD1MEX3
  • RNA-binding protein MEX3D
  • RNF193MEX-3D
  • TINObcl-2 ARE RNA binding protein

Background

RKHD1 - ring finger and KH domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5617
Species: Hu
Applications: WB
H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30707
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26616
Species: Hu
Applications: WB, IP

Publications for MEX3D Partial Recombinant Protein (H00399664-Q01) (0)

There are no publications for MEX3D Partial Recombinant Protein (H00399664-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEX3D Partial Recombinant Protein (H00399664-Q01) (0)

There are no reviews for MEX3D Partial Recombinant Protein (H00399664-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEX3D Partial Recombinant Protein (H00399664-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEX3D Products

Bioinformatics Tool for MEX3D Partial Recombinant Protein (H00399664-Q01)

Discover related pathways, diseases and genes to MEX3D Partial Recombinant Protein (H00399664-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEX3D Partial Recombinant Protein (H00399664-Q01)

Discover more about diseases related to MEX3D Partial Recombinant Protein (H00399664-Q01).
 

Pathways for MEX3D Partial Recombinant Protein (H00399664-Q01)

View related products by pathway.

Research Areas for MEX3D Partial Recombinant Protein (H00399664-Q01)

Find related products by research area.

Blogs on MEX3D

There are no specific blogs for MEX3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
MEX3D Antibody
NBP1-77332
Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MEX3D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MEX3D