METTL11B Antibody


Immunocytochemistry/ Immunofluorescence: METTL11B Antibody [NBP1-88494] - Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli & cytoplasm.
Immunohistochemistry-Paraffin: METTL11B Antibody [NBP1-88494] - Staining of human thyroid gland shows distinct nucleolar positivity in glandular cells.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

METTL11B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
METTL11B Protein (NBP1-88494PEP)

Alternate Names for METTL11B Antibody

  • C1orf184
  • methyltransferase like 11B
  • methyltransferase-like protein 11B
  • NTM1B
  • X-Pro-Lys N-terminal protein methyltransferase 1B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL11B Antibody (NBP1-88494) (0)

There are no publications for METTL11B Antibody (NBP1-88494).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL11B Antibody (NBP1-88494) (0)

There are no reviews for METTL11B Antibody (NBP1-88494). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for METTL11B Antibody (NBP1-88494) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional METTL11B Antibody Products

Bioinformatics Tool for METTL11B Antibody (NBP1-88494)

Discover related pathways, diseases and genes to METTL11B Antibody (NBP1-88494). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL11B

There are no specific blogs for METTL11B, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol METTL11B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88494 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought